General Information

  • ID:  hor007071
  • Uniprot ID:  P56174
  • Protein name:  Probable insulin-like peptide beta-type 5
  • Gene name:  NA
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Expressed by ASI and ASJ sensory neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Nematoda (roundworms); Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis; Caenorhabditis elegans
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005179 hormone activity; GO:0005158 insulin receptor binding
  • GO CC:  GO:0008355 olfactory learning; GO:1905910 negative regulation of dauer entry; GO:0008286 insulin receptor signaling pathway; GO:0008582 regulation of synaptic assembly at neuromuscular junction; GO:0040024 dauer larval development; GO:1902075 cellular response to salt; GO:0007635 chemosensory behavior

Sequence Information

  • Sequence:  PAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP
  • Length:  53
  • Propeptide:  MNSVFTIIFVLCALQVAASFRQSFGPSMSEESASMQLLRELQHNMMESAHRPMPRARRVPAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP
  • Signal peptide:  MNSVFTIIFVLCALQVAAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA